Protein Info for CA265_RS23555 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: NADH-quinone oxidoreductase subunit F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 99 to 123 (25 residues), see Phobius details TIGR01959: NADH oxidoreductase (quinone), F subunit" amino acids 7 to 426 (420 residues), 587.7 bits, see alignment E=4.1e-181 PF01512: Complex1_51K" amino acids 46 to 216 (171 residues), 159.3 bits, see alignment E=7.2e-51 PF10589: NADH_4Fe-4S" amino acids 343 to 425 (83 residues), 116.9 bits, see alignment E=3e-38

Best Hits

KEGG orthology group: K00335, NADH dehydrogenase I subunit F [EC: 1.6.5.3] (inferred from 91% identity to phe:Phep_4077)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain F (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZC65 at UniProt or InterPro

Protein Sequence (455 amino acids)

>CA265_RS23555 NADH-quinone oxidoreductase subunit F (Pedobacter sp. GW460-11-11-14-LB5)
MSRKLLLEHINVPGINTLEVYRQKGGYRAVEKALKTLTPEEIVEEVKKSGLRGRGGAGFP
TGMKWSFLAKPEGVARYLVCNADESEPGTFKDRYLMTYIPHALIEGMIVSSFALGAKVSY
IYVRGEMMPQIRILEKAIAEAKAAGWLGKNILGTGYDLELYVQPGGGAYICGEETALLES
LEGKRGNPRIKPPFPAIAGLYGCPTVVNNVESIAAVVPIINDGGDEYAKIGIGRSTGTKL
ISASGNLVKPGVYEIELGLPVEEFIYSDEYCGGIANGKQLKATVAGGSSVPILPANLTLK
YANGEPRLMSYESLSEGGFATGTMMGSGGFIAFDEDQCIVRNTWNFSRFYHHESCGQCSP
CREGTGWMEKVLHKIEHGHGSMEDVDLLWDIQRKIEGNTICPLGDAAAWPVASAIRHFRD
EFEWHIKEPVKSQSQNYGIANYATPIEKAPVTEEK