Protein Info for CA265_RS23550 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: NAD(P)H-dependent oxidoreductase subunit E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 TIGR01958: NADH-quinone oxidoreductase, E subunit" amino acids 21 to 168 (148 residues), 168.2 bits, see alignment E=6.7e-54 PF01257: 2Fe-2S_thioredx" amino acids 21 to 168 (148 residues), 170.8 bits, see alignment E=8.2e-55

Best Hits

Swiss-Prot: 44% identical to NUOE_RICCN: NADH-quinone oxidoreductase subunit E (nuoE) from Rickettsia conorii (strain ATCC VR-613 / Malish 7)

KEGG orthology group: K00334, NADH dehydrogenase I subunit E [EC: 1.6.5.3] (inferred from 79% identity to phe:Phep_4078)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain E (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZB16 at UniProt or InterPro

Protein Sequence (171 amino acids)

>CA265_RS23550 NAD(P)H-dependent oxidoreductase subunit E (Pedobacter sp. GW460-11-11-14-LB5)
MLKVEEQTPVVFSSELLAKFDEVKSRYPEGKHKSALLPLLHLVQAEYLWVSTPAMDKVAE
YLNIQPIEVYEVATFYTMYFLKPQGKYALEVCRTGPCCLVGAEKILSHLENKLGVKEGEV
TADGLFSFRGVECLAACGFGPVLQISPEYTFYENLTEASVDKLIEDLKNKS