Protein Info for CA265_RS23415 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: histidine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 PF00282: Pyridoxal_deC" amino acids 67 to 313 (247 residues), 79.6 bits, see alignment E=1.9e-26 PF00266: Aminotran_5" amino acids 77 to 255 (179 residues), 27.5 bits, see alignment E=1.6e-10

Best Hits

Swiss-Prot: 50% identical to DCHS_RHILO: Histidine decarboxylase (hdc) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K01590, histidine decarboxylase [EC: 4.1.1.22] (inferred from 64% identity to cly:Celly_1761)

MetaCyc: 46% identical to histidine decarboxylase subunit (Klebsiella aerogenes)
Histidine decarboxylase. [EC: 4.1.1.22]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZBU6 at UniProt or InterPro

Protein Sequence (377 amino acids)

>CA265_RS23415 histidine decarboxylase (Pedobacter sp. GW460-11-11-14-LB5)
MEASKLQEKDQQVLNDLLEKVKEQTDLFLGYPVSKDFDYQALSDFLKYPMNNLGDPFVTS
TYGVGSRELEKEVVQFFAELFRAPADNWWGYVTNGGSEGNLYGLYLARELHPKGMVYYSE
ATHYSVQKNLHLLNMSNIVIRTQENGEIDYEDLEHTIRMNRHMPVIIMANIGTTMTEARD
DVAKIKSILKKLAIQHYYIHADAALSGTYSALIEPRPAFDFEDGADSIAISGHKFFGSPM
PCGVVVAKKSNRDRIARSVAYIGSVDTTITGSRNGHSPLFLWHSIKRLGLAGLKSRAMHS
LATAAYTENKLKAIGIAAWRNVNAITVNFPTPSANICKKWQLAAEQGHSHIICMPNVMQS
HIDLLIADLKAEMMLQD