Protein Info for CA265_RS23395 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: ribosome biogenesis GTPase Der

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 TIGR03594: ribosome-associated GTPase EngA" amino acids 4 to 431 (428 residues), 544.1 bits, see alignment E=4e-167 PF00009: GTP_EFTU" amino acids 4 to 163 (160 residues), 31.4 bits, see alignment E=1.1e-10 amino acids 204 to 344 (141 residues), 45.7 bits, see alignment E=4.3e-15 PF01926: MMR_HSR1" amino acids 5 to 120 (116 residues), 101.1 bits, see alignment E=3.2e-32 amino acids 175 to 293 (119 residues), 93.7 bits, see alignment E=6.2e-30 PF02421: FeoB_N" amino acids 5 to 123 (119 residues), 47.1 bits, see alignment E=1.5e-15 amino acids 175 to 332 (158 residues), 44.4 bits, see alignment E=9.5e-15 TIGR00231: small GTP-binding protein domain" amino acids 5 to 151 (147 residues), 64.1 bits, see alignment E=2e-21 amino acids 173 to 334 (162 residues), 89.8 bits, see alignment E=2.5e-29 PF14714: KH_dom-like" amino acids 351 to 431 (81 residues), 104.9 bits, see alignment E=1.6e-33

Best Hits

Swiss-Prot: 60% identical to DER_GRAFK: GTPase Der (der) from Gramella forsetii (strain KT0803)

KEGG orthology group: K03977, GTP-binding protein (inferred from 84% identity to phe:Phep_3778)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZB95 at UniProt or InterPro

Protein Sequence (433 amino acids)

>CA265_RS23395 ribosome biogenesis GTPase Der (Pedobacter sp. GW460-11-11-14-LB5)
MSNIIAIVGRPNVGKSTLFNRLTESRKAIVDDMSGVTRDRHYGVGEWIDKQFTVIDTGGY
VANSEDVYEAAIREQVMIAIEEASVLVFMVDVTTGITDLDDDIAQVLRRSNKPVFVCANK
VDNTALYNEIHTFYGFGLGEVYPLSSMTGSGTGELLDEIVKNFEDIAEEENQLPKITIAG
RPNVGKSSLVNALIGKERNIVTANAGTTRDSIKIHYNQFGHEFMLIDTAGLRKKTKVKEN
LEFYSVMRTIKALEEADVVVLMIDAVEGIESQDINIFHLAEKNKKGIVILVNKWDLIEKN
TQTMKAFEEQIHERIRPFTDVPIIFTSVLNKQRIFKAIEAALEVYKNRSKKIPTSKLNDV
MLPLIEKFPPPALKGKHIKIKYITQINATSPMFAFFCNLPQYIKDPYKRFIENKLRENFD
FSGAPIQIYFRQK