Protein Info for CA265_RS23325 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 9 to 32 (24 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 245 to 268 (24 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details amino acids 314 to 335 (22 residues), see Phobius details amino acids 341 to 364 (24 residues), see Phobius details amino acids 376 to 399 (24 residues), see Phobius details amino acids 405 to 425 (21 residues), see Phobius details TIGR00879: MFS transporter, sugar porter (SP) family" amino acids 4 to 436 (433 residues), 388.4 bits, see alignment E=2.4e-120 PF00083: Sugar_tr" amino acids 16 to 438 (423 residues), 383.7 bits, see alignment E=2e-118 PF07690: MFS_1" amino acids 23 to 383 (361 residues), 129 bits, see alignment E=3.1e-41 amino acids 255 to 435 (181 residues), 44.5 bits, see alignment E=1.5e-15 PF06779: MFS_4" amino acids 36 to 190 (155 residues), 29.7 bits, see alignment E=6.6e-11

Best Hits

Swiss-Prot: 34% identical to IOLT_BACSU: Major myo-inositol transporter IolT (iolT) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 66% identity to cpi:Cpin_3592)

Predicted SEED Role

"sugar-proton symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZB86 at UniProt or InterPro

Protein Sequence (443 amino acids)

>CA265_RS23325 MFS transporter (Pedobacter sp. GW460-11-11-14-LB5)
MSQSKFNTAYITFISLLAAGGGYLFGFDFAVISGSLPFLEKQFQLTPYWEGFATGSLALG
AMVGCLIAGYVSDAYGRKPGLMIAAFVFLASSLAMAMAPNRDFFIVSRFFSGIGVGMASM
LSPMYIAELAPPKFRGRLVAINQLTIVLGILITNLINYTLRNTGEDAWRWMFGLGAIPSG
IFLIGISILPESPRWLVQKGKNEKALKVLNKIGNHEFAADALKNIEQTLQRKSNVEHESI
FNKMYFPAVMIGIGLAIFQQFCGINTVFNYAPKLFESIGTSQDDQLLQTVFIGAVNVIFT
ISAMFLVDKIGRKPLMLIGAGGLAVLYVLISQLLASGSTMVSWFLLSAIGVYAVSLAPVT
WVLISEIFPNKVRVKATTWAILCLWGAYFVLVFTFPILFDWLKESIFYIYAAICTLGCIG
IWKFVKETKGKTLEEIEDIQIVH