Protein Info for CA265_RS23300 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 PF01408: GFO_IDH_MocA" amino acids 8 to 127 (120 residues), 91.4 bits, see alignment E=7.2e-30 PF02894: GFO_IDH_MocA_C" amino acids 145 to 358 (214 residues), 29.8 bits, see alignment E=5.4e-11

Best Hits

KEGG orthology group: None (inferred from 81% identity to phe:Phep_2670)

Predicted SEED Role

"hypothetical oxidoreductase related to N-acetylglucosamine utilization" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZC94 at UniProt or InterPro

Protein Sequence (361 amino acids)

>CA265_RS23300 oxidoreductase (Pedobacter sp. GW460-11-11-14-LB5)
MSTGNKNLKVLVVGCGNMGASHATAYHTLPGFEICGLVSTGKSKEKLNEKLGGQYDLYTD
FYEALEITKPDAVCISTYPDTHEAYAIKSFESGCHVFIEKPLADSVAGAIKVAEAAKKAN
KKLLVGYILRYHPSWEKFTELAQEMGKPLVMRMNLNQQSHGPKWTVHRNLMKSLSPIVDC
AVHYIDIMCQMTRSKPVQVSAIGARLTDDIPEWNYNYGQLQIRFEDGSVGWYEAGWGPMV
SDNAFFIKDVFGPKGSVSITAKKAGAAGNSDNIDAHTKTESIKIHHADLDEHDEFSKADE
WVDLTDEPDHQELCNREQRYFLKAITEDIDLTNATDDAVNSLKIAFACDESVKTGEMIRL
E