Protein Info for CA265_RS23145 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 52 to 77 (26 residues), see Phobius details amino acids 97 to 121 (25 residues), see Phobius details PF06580: His_kinase" amino acids 140 to 217 (78 residues), 96.5 bits, see alignment E=4.5e-32

Best Hits

KEGG orthology group: None (inferred from 68% identity to phe:Phep_0216)

Predicted SEED Role

"putative two-component system sensor protein, no kinase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZCW3 at UniProt or InterPro

Protein Sequence (325 amino acids)

>CA265_RS23145 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MIIVGGNIFDTTKHTMKDYFISYVVYGIINISIFYINYIFLIPSLIKKRKKYLIYVLAFL
LLIAVSVVAKTAIAVLYPDDVLTTVSAKGKRMEIPVHNFVILVTFLSGFFLICSCIIKFT
IDWFASERIQRNLESERREMELQFLKSQLNPHFLFNSLNNIYSLAYQKSDKTADAIMKLS
EIMRYMIYESNTPTVALSKEVDYLTSYIELQKIRFKDGAYIELTLNGEIDNQKIVPLMLI
SFVENAFKHGVVNDPAEPIKINIIANQKILHFSVVNKKNQQNKDAQGGVGLTNVERRLQL
VYPDRYKLNVVNSATHYTCELMIDI