Protein Info for CA265_RS22915 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 129 to 146 (18 residues), see Phobius details amino acids 153 to 176 (24 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details PF03006: HlyIII" amino acids 7 to 203 (197 residues), 138.6 bits, see alignment E=1.3e-44

Best Hits

KEGG orthology group: K11068, hemolysin III (inferred from 36% identity to bwe:BcerKBAB4_5245)

Predicted SEED Role

"COG1272: Predicted membrane protein hemolysin III homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZBG3 at UniProt or InterPro

Protein Sequence (212 amino acids)

>CA265_RS22915 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MILVRKLREPVNFFTHFIPALIAIPAGYILLQKCNTPIEYTAAWIYSIGTFILFGVSAMY
HGYPATDYGVRFWQKFDHCCIYLMIAGSYTPTALLVFDGWLRWSLFAIVWIIAMVGCLLK
IFNRLKSTAISLSIYILMGCLIVPLLRKMLGTLPVGAIFWLLFGGIFYIAGTYYYAKDKQ
MFRWMHSHELWHLFVIGGALSHYIYNLVYIFK