Protein Info for CA265_RS22835 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: ATP-dependent DNA helicase RecG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 701 PF17191: RecG_wedge" amino acids 9 to 162 (154 residues), 53.4 bits, see alignment E=6.9e-18 TIGR00643: ATP-dependent DNA helicase RecG" amino acids 29 to 665 (637 residues), 728.9 bits, see alignment E=3.2e-223 PF01336: tRNA_anti-codon" amino acids 64 to 137 (74 residues), 37.5 bits, see alignment E=5.7e-13 PF04851: ResIII" amino acids 270 to 430 (161 residues), 47 bits, see alignment E=8.1e-16 PF00270: DEAD" amino acids 274 to 436 (163 residues), 91.1 bits, see alignment E=2.1e-29 PF00271: Helicase_C" amino acids 478 to 588 (111 residues), 62 bits, see alignment E=1.8e-20 PF19833: RecG_dom3_C" amino acids 617 to 693 (77 residues), 80.6 bits, see alignment E=2.3e-26

Best Hits

KEGG orthology group: K03655, ATP-dependent DNA helicase RecG [EC: 3.6.4.12] (inferred from 76% identity to phe:Phep_0158)

Predicted SEED Role

"ATP-dependent DNA helicase RecG (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZAP0 at UniProt or InterPro

Protein Sequence (701 amino acids)

>CA265_RS22835 ATP-dependent DNA helicase RecG (Pedobacter sp. GW460-11-11-14-LB5)
MFNSVLDTPVEFLKGVGPSRADVLKKDLGLFTYQDMLAHYPFRYIDRTKYFKINQINPDS
QYIQIIGRVISKKVIGDKRAKRIIAVFKDETGIMELVWFQSLKWVDDNITVGTAYVAFGK
PSIFNGTFSISHPEMELYQRKQVGRGNLTLQPVYNSTEKLKKFNLDSKGLQRLIAGLLDQ
IIPQVPENLPPYIIDKYQLPDKRLALLNIHFPKNQQDLSAAERRLKFEELFFIQLQLLHN
KHLRQLKFKGVTFEKVGEKVNRFYNEFLPFELTNAQKRVVKEIRIDTQRGVQMNRLVQGD
VGSGKTAVALMSMLLANDNGYQACMMAPTEILARQHYASITSLVTDDLVRVAILTGNTKK
KERTILHEQLESGEIDILIGTHALIEDKVQFRNLGLVVIDEQHRFGVEQRAKLWRKNIIP
PHILVMTATPIPRTLAMTLYGDLDVSIIDELPAGRKPIETKHLFEGQRLRMFGFMKQEIA
KGRQVYIVYPLIKESEKLDLLHLEAGIEQLSYQFPRPDYQMSIVHGQMPNADKQFEMQQF
IDGKSQIMVATTVIEVGVNVPNASVMVIENAERFGLSQLHQLRGRVGRGAEQSFCILMSG
NKLSKEGKIRLETMVRTNNGFEISEIDLQLRGPGDITGTQQSGVLDLKLADLAKDQIILS
EARNTVIALFEDDPQLAKPENAILKAYLQKLERGISFDKIS