Protein Info for CA265_RS22735 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: transcription termination/antitermination protein NusA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 PF08529: NusA_N" amino acids 7 to 129 (123 residues), 102.8 bits, see alignment E=1.4e-33 TIGR01953: transcription termination factor NusA" amino acids 8 to 346 (339 residues), 380.3 bits, see alignment E=3.7e-118 PF13184: KH_5" amino acids 235 to 302 (68 residues), 96.4 bits, see alignment E=8.4e-32

Best Hits

Swiss-Prot: 37% identical to NUSA_THET8: Transcription termination/antitermination protein NusA (nusA) from Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)

KEGG orthology group: K02600, N utilization substance protein A (inferred from 94% identity to phe:Phep_0140)

Predicted SEED Role

"Transcription termination protein NusA" in subsystem NusA-TFII Cluster or Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZBR2 at UniProt or InterPro

Protein Sequence (414 amino acids)

>CA265_RS22735 transcription termination/antitermination protein NusA (Pedobacter sp. GW460-11-11-14-LB5)
MSTTTINLIDSFQEFKDFKNIDRPTVISVLEEVFRSMLRKKYGTDENCDVIVNPDNGDLE
IWRTRKVMEDGFSEDDDLEIELAEVSKLDSTLEVGDDYIEQITLESFGRRAILAARQTLV
SKVLELEKDEIFKKYKDRVGEIVTGEVYQVWKKETLVLDDEGNELLMPKTEQIPADYFKK
GDSVRAVISKVEMINANPKIIISRTAPEFLQRLFEQEVPEIFDGLITVKKIVREPGERAK
VAVESYDDRIDPVGACVGMKGSRIHGIVRELKNENIDVINFTNNISLYITRALSPAKITS
IKLDDETKHASVYLKPDQVSLAIGRGGHNIKLAGKLTGYEIDVYREAGEESDEDVDLEEF
SDEIDSWIIDELKAIGCDTAKSVLALTVEDLVKRTDLEEETIKEVVQILKSEFE