Protein Info for CA265_RS22660 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: DNA repair protein RadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 TIGR00416: DNA repair protein RadA" amino acids 1 to 451 (451 residues), 606.6 bits, see alignment E=1.4e-186 PF18073: Rubredoxin_2" amino acids 9 to 35 (27 residues), 45.5 bits, see alignment (E = 2.1e-15) PF13481: AAA_25" amino acids 66 to 222 (157 residues), 53.3 bits, see alignment E=1.2e-17 PF03796: DnaB_C" amino acids 75 to 137 (63 residues), 28.8 bits, see alignment E=3.6e-10 PF06745: ATPase" amino acids 76 to 139 (64 residues), 39.9 bits, see alignment E=1.5e-13 PF00004: AAA" amino acids 95 to 216 (122 residues), 26 bits, see alignment E=5e-09 PF13541: ChlI" amino acids 342 to 430 (89 residues), 40.4 bits, see alignment E=1.2e-13 PF05362: Lon_C" amino acids 357 to 455 (99 residues), 24.7 bits, see alignment E=7.1e-09

Best Hits

Swiss-Prot: 53% identical to RADA_LISMO: DNA repair protein RadA (radA) from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)

KEGG orthology group: K04485, DNA repair protein RadA/Sms (inferred from 84% identity to phe:Phep_0125)

Predicted SEED Role

"DNA repair protein RadA" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZAJ3 at UniProt or InterPro

Protein Sequence (458 amino acids)

>CA265_RS22660 DNA repair protein RadA (Pedobacter sp. GW460-11-11-14-LB5)
MAKSKSAFFCQSCGYESAKWLGKCPSCNQWNTFVEEIVEKSSAAVPTWKSDTSSRKLSKP
SKVDEIQSSTERRILTGDKELDRVLGGGLVEGSLVLIGGEPGIGKSTLMLQLALNLKGKK
LLYISGEESEQQIKMRAERIQESPSSNCYILTETSTQNIFKQIEILEPEILVVDSIQTLH
SAHIDSTPGSVSQVRECTAELLRFAKETGVPVFLIGHITKDGAIAGPKILEHMVDTVLQF
EGDRHHVYRILRSIKNRFGAAAELGIYEMQGSGLREVSNPSEILLSQRDEELSGIAIAAT
LEGARPMLIETQALVSSAAYGTPQRSATGFDTKRMNMLLAVLEKRCGFRLSTQDVFLNIA
GGIRVEDPAIDLAILIAIISSHQDIAVSSKNCFAAEVGLSGEIRAVNRIEQRIAEADKLG
FETIYISKYNLKGIATEKYNLEIKAVSKIEEVFSLVFG