Protein Info for CA265_RS22405 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 transmembrane" amino acids 21 to 48 (28 residues), see Phobius details amino acids 60 to 78 (19 residues), see Phobius details amino acids 109 to 133 (25 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 202 to 225 (24 residues), see Phobius details amino acids 279 to 295 (17 residues), see Phobius details amino acids 308 to 330 (23 residues), see Phobius details amino acids 351 to 373 (23 residues), see Phobius details amino acids 382 to 404 (23 residues), see Phobius details amino acids 425 to 443 (19 residues), see Phobius details amino acids 450 to 473 (24 residues), see Phobius details PF18940: DUF5687" amino acids 9 to 490 (482 residues), 517.6 bits, see alignment E=2.5e-159

Best Hits

KEGG orthology group: None (inferred from 72% identity to phe:Phep_0183)

Predicted SEED Role

"FIG00908689: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZAS6 at UniProt or InterPro

Protein Sequence (490 amino acids)

>CA265_RS22405 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MLSTFLSHQRKSFWRSRNRGSSIAGQVVLGFFMLYFFAVAVGIGFGMSIFLPKIFPDQNI
LTSFNGIILYYFAFDFIMRMQFQELPTLSIIPYLHLKIQKSKIIKFLNVKALFSAFNLWP
FFIFLPFCFVRIWGEHGALVTIMYIVSIFSIMIFNNYMVLYIKRKSITNTLYTFLGLVVI
AAFAALEYYKVISIMAGSDVVFRAIAAHPLYGFAFTIAAVAIFYLNSNFLRKNLYVEELS
AKQEKKGSTDYAFLNRFGKVGELAALELKLILRHKRPRSSVILGFFFLFYGFIFYKEKAI
DRDAFGQMMFGAIFMTGVSIIIYGQFMFAWQSAHFDGILANKINFKDYIRAKFLLFTIGC
TIITLLASFYGFLSPKLLLLHLAAYLYNIGFGTVVVLYLATLNYKRLDITKAASFNYQGT
GATQWLLMFPYALTPILIYLPFGILNKPYWGLVAVSVFGLAMLLLRGFWVNYIAKRLELQ
RYKIAEGFRE