Protein Info for CA265_RS22385 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 PF13489: Methyltransf_23" amino acids 12 to 127 (116 residues), 31.9 bits, see alignment E=2.6e-11 PF13847: Methyltransf_31" amino acids 32 to 131 (100 residues), 37.1 bits, see alignment E=6.5e-13 PF13649: Methyltransf_25" amino acids 39 to 123 (85 residues), 51.4 bits, see alignment E=3.7e-17 PF08241: Methyltransf_11" amino acids 39 to 126 (88 residues), 61.7 bits, see alignment E=2.2e-20 PF08242: Methyltransf_12" amino acids 39 to 125 (87 residues), 37.6 bits, see alignment E=7.6e-13

Best Hits

Swiss-Prot: 35% identical to Y8948_DICDI: Putative methyltransferase DDB_G0268948 (DDB_G0268948) from Dictyostelium discoideum

KEGG orthology group: None (inferred from 54% identity to zpr:ZPR_2729)

Predicted SEED Role

"SAM-dependent methyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZDM7 at UniProt or InterPro

Protein Sequence (243 amino acids)

>CA265_RS22385 SAM-dependent methyltransferase (Pedobacter sp. GW460-11-11-14-LB5)
MKDNFSTQSADYAIYRPTYPQELYDYLFSLIKNKETAWDCATGNGQVARVLAQHFNAVYA
TDISENQLKNALQLPNITYKVEPAEQSSVGNDSFDLITVAQAIHWFNFEAFYAEVKRTLK
PDGLFAVIGYGLMFIDKKVDKAVHKLYEDILGKYWDSERRYIEEGYKTIPFPFEEITAPH
FQIKSTWNFNQLIGYLNTWSSLQHYKKVNERNPLEYMFTELKEAWGDDAEKNVHFPVLLR
IGR