Protein Info for CA265_RS22020 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: peptide chain release factor 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 TIGR00019: peptide chain release factor 1" amino acids 1 to 353 (353 residues), 487.3 bits, see alignment E=1.3e-150 PF03462: PCRF" amino acids 10 to 202 (193 residues), 255.7 bits, see alignment E=3.1e-80 PF00472: RF-1" amino acids 209 to 319 (111 residues), 131.7 bits, see alignment E=1.2e-42

Best Hits

Swiss-Prot: 58% identical to RF1_CYTH3: Peptide chain release factor 1 (prfA) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K02835, peptide chain release factor 1 (inferred from 92% identity to phe:Phep_4117)

Predicted SEED Role

"Peptide chain release factor 1" in subsystem LMPTP YwlE cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZAL2 at UniProt or InterPro

Protein Sequence (357 amino acids)

>CA265_RS22020 peptide chain release factor 1 (Pedobacter sp. GW460-11-11-14-LB5)
MLDKLEAIKLRWEDVEESLSNPDVIQDMKRFAALNKEYKDLGKIVDEYKIYKNVMSNIDA
NKEILATEKDAEMREMAKEELDLLLKQQEEMESNIRLMLIPKDPEDAKNAVFEIRGGTGG
DEAALFAGDLYRMYTRYFETKGWKVETVDVTEGTAGGYKEVILKVSGDDVYGQLKYESGV
HRVQRVPDTETQGRVHTSAASVAVLPEAEEIDLYINPADIELQTSRSGGAGGQNVNKVET
KVQLTHKPSGIVVVCQQERSQLGNRVIAMEMLRSKLYDIELQKKNGDIAAKRKTMVSTGD
RSAKIRTYNYPQGRVTEHRIGLTMYNLPTIMDGDIQEIIDALQFAENAEKMQEGAVG