Protein Info for CA265_RS21775 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 57 to 79 (23 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details PF03547: Mem_trans" amino acids 9 to 293 (285 residues), 97 bits, see alignment E=4.6e-32

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 52% identity to lby:Lbys_0728)

Predicted SEED Role

"Malate permease" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZAV2 at UniProt or InterPro

Protein Sequence (303 amino acids)

>CA265_RS21775 transporter (Pedobacter sp. GW460-11-11-14-LB5)
MANFILIGLCIVAGILFRKSKSLPKDAHKGINAWIIYIALPAVSFKYLPHITWTKDLLFP
ALAPICIWLFGWLFITLYSRIQNMSKATSGGLKLTSSLSNTSFVGFPLIVAYFSEKELAV
AIICDQVTFTLLSTIGIIVAIRSSQHQKLSPKLVLKKVLTFPPLIGCVLALSLPHFINLS
SLDPLFEKLAGTVGPLALFSIGLQLKFGGWFSELKHISFALLYKLILAPLVVLLLALVLG
MNGMITKITIFEMAMPTLLTAGVVADQYNLNPKLSNLVVGIGILLSFMTTGLWWLVLTYS
GLV