Protein Info for CA265_RS21390 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: metal-dependent hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 PF12867: DinB_2" amino acids 32 to 168 (137 residues), 76.8 bits, see alignment E=1.1e-25

Best Hits

Swiss-Prot: 50% identical to Y2476_BACHK: Putative metal-dependent hydrolase BT9727_2476 (BT9727_2476) from Bacillus thuringiensis subsp. konkukian (strain 97-27)

KEGG orthology group: None (inferred from 51% identity to ppm:PPSC2_c1451)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZB15 at UniProt or InterPro

Protein Sequence (174 amino acids)

>CA265_RS21390 metal-dependent hydrolase (Pedobacter sp. GW460-11-11-14-LB5)
MDIEKLKYPIGQFSMPEIFDQKQIDTWISEIEALPGQLKNATENLTDEELNQTYRPEGWT
LRQVVHHIPDSHINAYIRFKQAITEDIPVIRPYYEERWAETGEAKGGDIKLSIDLLTALH
LRWVAFLKTLKPEDYQRKYIHPALGKELSLANMLGMYAWHGKHHLTHITNTTVK