Protein Info for CA265_RS21170 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: thiamine-phosphate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01379: thiamine-phosphate kinase
  • amino acids 14 to 344 (331 residues), 312.3 bits, E=1.6e-97
• PF00586: AIRS
  • amino acids 38 to 150 (113 residues), 94.3 bits, E=6.7e-31
• PF02769: AIRS_C
  • amino acids 212 to 321 (110 residues), 24.2 bits, E=3.4e-09

Best Hits

KEGG orthology group: K00946, thiamine-monophosphate kinase [EC: 2.7.4.16] (inferred from 83% identity to phe:Phep_0014)

Predicted SEED Role

"Thiamine-monophosphate kinase (EC 2.7.4.16)" in subsystem Thiamin biosynthesis (EC 2.7.4.16)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (9/10 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• thiamine diphosphate salvage V (2/3 steps found)
• thiamine diphosphate salvage I (1/2 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.16

Sequence Analysis Tools

See A0A1X9ZAX4 at UniProt or InterPro

Protein Sequence (346 amino acids)

>CA265_RS21170 thiamine-phosphate kinase (Pedobacter sp. GW460-11-11-14-LB5)
MFENKERTDINELGEFGLIKHLTTNFKIKNDYSVKGVGDDAAVLDAKGKQTLISTDLLLE
GIHFDLAYVPLMHLGYKAVQVNLSDIYAMNGKASQITVSLGLSSKFPLEAVEEIYKGIEL
ACNKYNIDLIGGDTSSSKQGLVISITSIGYADADKVVYRNGAQEHDLLCVSGDLGGAYLG
LQILEREKLIYLENPQIQPDLEGKDYIIERQLKPEARMDIVALLDEMNIKPTSMIDVSDG
LASEILHLAEQSDKGITIYEEKIPLDPMTYETARELGLDPTVCALSGGEDYELLFTISQE
DYKKLKHDVDITVIGHVTDKNSGCKMVSKSEKVHELKAQGWNAFNK