Protein Info for CA265_RS21125 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: tRNA dihydrouridine synthase DusB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00737: putative TIM-barrel protein, nifR3 family
  • amino acids 5 to 324 (320 residues), 328.6 bits, E=2e-102
• PF01207: Dus
  • amino acids 16 to 303 (288 residues), 285.4 bits, E=2.7e-89

Best Hits

KEGG orthology group: None (inferred from 84% identity to phe:Phep_0018)

Predicted SEED Role

"tRNA dihydrouridine synthase B (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

See A0A1X9ZAH0 at UniProt or InterPro

Protein Sequence (335 amino acids)

>CA265_RS21125 tRNA dihydrouridine synthase DusB (Pedobacter sp. GW460-11-11-14-LB5)
MSVKIGNIDLGEFPLLLAPMEDVSDPPFRYVCKKNGADMMYTEFISSEGLIRDAAKSIQK
LDIFEYERPIGIQIFGGDIDHMREASEIASAAGPDLVDINYGCPVKNVVCKGAGSSLLQD
IDKMVKMTEAVVKASHLPVTVKTRLGWDDNTKNVYEVAERLQDVGIQALTIHGRTRAQLY
KGEADWSLIREIKRNPRIKIPIFGNGDVDSPEKAANWRMEYEIDGIMIGRAAIGYPWIFR
EVKHFFKTGEHLAGPTIEERIEVCRTHLDKSLEWKGPKTGIFEMRRHYANYFKGLPDFKP
YRMRLVAEPDINNIYSILEEVAEKFADYDATKVLA