Protein Info for CA265_RS21075 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 PF13173: AAA_14" amino acids 20 to 142 (123 residues), 88 bits, see alignment E=8.7e-29 PF13635: DUF4143" amino acids 190 to 346 (157 residues), 85.4 bits, see alignment E=4.8e-28

Best Hits

KEGG orthology group: K07133, (no description) (inferred from 59% identity to dfe:Dfer_4042)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZAG0 at UniProt or InterPro

Protein Sequence (378 amino acids)

>CA265_RS21075 ATPase (Pedobacter sp. GW460-11-11-14-LB5)
MESQIIRSLKPIILNKIGKNKVILIFGTRRVGKTWLVESIIKDANINHLSLNGEDQDVQV
LLSTLTAANYKRVLGDAKLLIIDEAQVIPEIGKVLKLLIDTFKDLTIIASGSSTFDLSNQ
TGEPLTGRSLTYYLYPIAQVELNKQENALQTAQNLEERLIFGSYPELFHLNSITEKAQYL
TELVKSYLLKDILMYENIQNSAKLLELLKLIAYQVGSEVSIDEISRNLGISKNTVDRYLD
LLSKVFIIYKVGGYSNNLRKEITKSSKWYFHDNGIRNAIVNDFRLIALRNDQGLLWENYC
FSERIKKMEYEQHNATYYFWRTYDQQEIDLIEVKNGEILAADFKWGNQKKKIPGFFAKNY
PEATFSVINKENYLDFIL