Protein Info for CA265_RS20910 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: mechanosensitive ion channel protein MscS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 117 to 142 (26 residues), see Phobius details amino acids 163 to 180 (18 residues), see Phobius details amino acids 186 to 203 (18 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 206 to 271 (66 residues), 72.1 bits, see alignment E=3.2e-24 PF21082: MS_channel_3rd" amino acids 278 to 362 (85 residues), 44.7 bits, see alignment E=1.5e-15

Best Hits

KEGG orthology group: None (inferred from 62% identity to phe:Phep_0042)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZAC8 at UniProt or InterPro

Protein Sequence (391 amino acids)

>CA265_RS20910 mechanosensitive ion channel protein MscS (Pedobacter sp. GW460-11-11-14-LB5)
MLDSAFFDQVFWGNTVKAYFLFGGILFLGLVFKNIVSKLLSRLLFKLFKNFSNQSHNDAF
VALLVKPIEVFILLTTLYLSINQLKHPLEVAVFHYSKLIGKVKELIPVTIGDCVDRIFLF
GIILSVFWIILRIIDFISHVLLYKASLTDNKADDQLVPFLKELFKTIVIFIGFFTLLGFV
FEVNVLTLITGLGIGGIAIALAAKESLENLIGSFTIFLDKPFTVGDLVKVDGVEGTVEKV
GFRSTRIRTSEKTMATIPNRGMIDGVLENLSLRNSRKVSFIIGLTYETNSASLRKIISEI
ESYINSHQGTSDDGNASFKSFGDSGLNVEVNYFVTVLEYAEFLKIRQEINLEIMDIVIRN
KSDFAYPTQRLISDRPAPAGTNEEVGNDATD