Protein Info for CA265_RS20205 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: very short patch repair endonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF03852: Vsr" amino acids 25 to 95 (71 residues), 103.6 bits, see alignment E=4e-34 TIGR00632: DNA mismatch endonuclease Vsr" amino acids 28 to 138 (111 residues), 136.6 bits, see alignment E=2.5e-44 PF04480: DUF559" amino acids 116 to 153 (38 residues), 25.2 bits, see alignment 1.3e-09

Best Hits

KEGG orthology group: K07458, DNA mismatch endonuclease, patch repair protein [EC: 3.1.-.-] (inferred from 62% identity to shg:Sph21_0962)

Predicted SEED Role

"Very-short-patch mismatch repair endonuclease (G-T specific)" in subsystem DNA repair, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z9B0 at UniProt or InterPro

Protein Sequence (167 amino acids)

>CA265_RS20205 very short patch repair endonuclease (Pedobacter sp. GW460-11-11-14-LB5)
MATKKYPEDKDVIKVPRFEEAAGFYTTIERSKRMANIKSKNTKAEVLLRKALWAKGLRFR
IHVKNMPGKPDIVINKYRLAIFVDGSFWHGYKWEQKKAEIKSNMDFWIPKIESNMLRDVK
NSKDLEDAGYTVMRFWDHQIKKELKKCINQICLYVETAKTSSIPSLM