Protein Info for CA265_RS20120 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: rhomboid family intramembrane serine protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 50 to 78 (29 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 139 to 164 (26 residues), see Phobius details amino acids 176 to 200 (25 residues), see Phobius details PF01694: Rhomboid" amino acids 47 to 192 (146 residues), 88.8 bits, see alignment E=1.9e-29

Best Hits

KEGG orthology group: None (inferred from 64% identity to phe:Phep_0099)

Predicted SEED Role

"GlpG protein (membrane protein of glp regulon)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZAG9 at UniProt or InterPro

Protein Sequence (207 amino acids)

>CA265_RS20120 rhomboid family intramembrane serine protease (Pedobacter sp. GW460-11-11-14-LB5)
MTLMEYFNIAPVASVIFVFTIITSLYAFYDHSLYGKFMLHPYSVSRGHKVWTVLTSGLIH
GDWMHLFFNMFTFVAFAFTLEQLMGSWLFGLLYVIALVLSDLPTIFKYKENFNYNSLGAS
GAISAVLFSFILFNPKSAIRILFIPFDIPAYAFGILYLIYCYYASRNSRDGINHDAHFFG
ALTGLIFTIIFVPGILQNFITMLTGGR