Protein Info for CA265_RS19925 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 62 (24 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details PF01062: Bestrophin" amino acids 17 to 274 (258 residues), 146.5 bits, see alignment E=6e-47

Best Hits

KEGG orthology group: K08994, putative membrane protein (inferred from 34% identity to dfe:Dfer_0039)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z991 at UniProt or InterPro

Protein Sequence (296 amino acids)

>CA265_RS19925 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MLLIQNIRLSRILRNTWHVDLIMIASCTAAYFVREYLIAHHFSIPSIIPTVLGTAIAFFI
GFNNNQAYDRWWEARKIWGALVNDSRSFARALINYVDEDEESVKRMVYRHIAFLYALKAN
LRGTIDEIYTKYLSEADLKEIEKHNNTHNAILNIQSRDLQKLSKANAIDGFRFIEINEML
TRFSDSMGMSERIKNTIFPTTYTYLTKVFIWLFVVTFTLVISQDAGPAAIFLGWLIGFVF
VSTQINGMSLVNPFENNSAGVPLNQITRTIEINLLQMLEDDEIPEPVKPINDEYVL