Protein Info for CA265_RS19920 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 50 to 73 (24 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details amino acids 410 to 434 (25 residues), see Phobius details amino acids 450 to 472 (23 residues), see Phobius details amino acids 479 to 497 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 18 to 225 (208 residues), 108.7 bits, see alignment E=3.6e-35 PF07690: MFS_1" amino acids 19 to 321 (303 residues), 83.2 bits, see alignment E=1.8e-27

Best Hits

KEGG orthology group: None (inferred from 84% identity to phe:Phep_4227)

Predicted SEED Role

"putative sugar transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z954 at UniProt or InterPro

Protein Sequence (507 amino acids)

>CA265_RS19920 MFS transporter (Pedobacter sp. GW460-11-11-14-LB5)
MSDTLPRNNIFKVIGASSLGTLIEWYDFYIFGSLAVIIGHQLFPEDAGASALINTLAIFA
AGFIVRPFGALVFGRLGDLIGRKYTFLLTLVLMGGSTFFIGLIPSYKSIGYAAPILVLIL
RLIQGLALGGEYGGAATYVAEHAPKNKRGFFTSWIQTTATLGLFLSLGIIVITKNILGAE
TFGDWGWRIPFLLSIVLVVVSIYIRMKMHESPMFSKLKAEGNVSKNPLKESFNNKANFKM
VLLALFGATMGQGVIWYTGQFYAQSFLENTCKLDFNDSRYILLWGIAFATPFFVIFGAWS
DKVGRKWIMLSGMLLGILFYRPIYQIFLDDTDYTKIEQTDILSARPAPVTSVLIANSTDS
LRTVSTKVMLKNGASFNKVQTDTVSATKGILLGKEVVKDKILPTPVFWKFVGLIFFQILL
VTMVYGPIAAFLVELFPTKIRYTSMSLPYHIGNGVFGGLVPFIATLIASFSGSTPLSGLW
YPIGIAALSLVIGAIYLSNKRDENIND