Protein Info for CA265_RS19910 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: GDSL family lipase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00657: Lipase_GDSL" amino acids 28 to 250 (223 residues), 47.6 bits, see alignment E=2.4e-16 PF13472: Lipase_GDSL_2" amino acids 31 to 215 (185 residues), 48.9 bits, see alignment E=1.2e-16

Best Hits

KEGG orthology group: None (inferred from 57% identity to psn:Pedsa_3368)

Predicted SEED Role

"rhamnogalacturonan acetylesterase" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z9A5 at UniProt or InterPro

Protein Sequence (263 amino acids)

>CA265_RS19910 GDSL family lipase (Pedobacter sp. GW460-11-11-14-LB5)
MKKYKILIATLGVILLMSFLIKPKPVKVYLIGDSTVADYTLDEGYQQKKYPITGWGQVFQ
QFLKKDSLKKLNRLIKSDSALVIDKAKGGRSTRTFFEEGRWKEVLSTLEKNDLVLIQFGH
NDAAKDKPERYVDIPGYKDFLRMYVKETRAQGALPVLITPVTRNYPWKDGKLGSAHGEYP
QAVKDVAQELNVSIIDLTSLSAAFFTTKGSEFVSKHYFMNLDSAKYEAYPKGQKDNTHFQ
PEGARAVAQLVYNELKNINHKTD