Protein Info for CA265_RS19545 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 6 to 34 (29 residues), see Phobius details PF01145: Band_7" amino acids 22 to 198 (177 residues), 109.4 bits, see alignment E=1.1e-35

Best Hits

KEGG orthology group: None (inferred from 87% identity to phe:Phep_0167)

Predicted SEED Role

"Putative stomatin/prohibitin-family membrane protease subunit YbbK" in subsystem YbbK

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z937 at UniProt or InterPro

Protein Sequence (313 amino acids)

>CA265_RS19545 protease (Pedobacter sp. GW460-11-11-14-LB5)
MQYTIYIIAVVGFIILLSSFVTVKQGTIAVVTVFGKYRRQLRPGLNFKIPLIEQIYSRIS
IQNRSVELSFQAVTQDQANVYFKAMLLYSVVNQDEETIKNVAFKFVDATNLMQALIRTIE
GSIRAYVATQKQANVLAQRNEIVLHVKEQIDQVLDGWGYHLQDLQLNDITFDEEIMRSMS
RVVASNNLKAAAENEGQALLITKTKAAEADGNAIKIAATAEREAAQLRGQGIALFRAEVA
HGMSKAAQEMEQANLDISVILFTMWTESIKHFAENGDGNVIFLDGSSEGMNRTMKEMMAM
QLNKQTEPTAKKG