Protein Info for CA265_RS19035 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF13181: TPR_8" amino acids 71 to 100 (30 residues), 14.7 bits, see alignment (E = 2.5e-05) amino acids 308 to 340 (33 residues), 14 bits, see alignment (E = 4.2e-05) amino acids 414 to 447 (34 residues), 26.7 bits, see alignment (E = 3.5e-09) PF13432: TPR_16" amino acids 209 to 259 (51 residues), 17.1 bits, see alignment 5.8e-06 amino acids 302 to 337 (36 residues), 20.4 bits, see alignment 5.3e-07 amino acids 420 to 482 (63 residues), 25.9 bits, see alignment E=9.8e-09 PF07719: TPR_2" amino acids 308 to 339 (32 residues), 23.6 bits, see alignment (E = 3.4e-08) PF13174: TPR_6" amino acids 420 to 446 (27 residues), 13.1 bits, see alignment (E = 0.00011)

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z8P5 at UniProt or InterPro

Protein Sequence (565 amino acids)

>CA265_RS19035 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MKYKVHFLVGATLMGFQAFGQGVVTPSNNRDSNMVKQLFFAGLREKMSENYVVASTNFNK
IVGLDPNNHAAYFELANANLRLDKLSEAEQNIKQAIKLNAGNLWYWRLLGEVYKRTNKMP
ELIEVFNQLIRLDPENDAYYFDKANAQFLANQLDAAKKTYEEIQAKFGESRDLVNAKKRL
QSNGNASESDIVKLLEGNQADVKNYLYAAGLLLQKGNDPEALKVLTKAQQLEPHNFEVNL
ALADIYRRQKNDEAAFSSLKLAFESNEMPLTEKVKIIAALFPKLNQPIVAKNVTELSKLV
AEKNPAEAKALALYGDVLYQQNNLKEALTQYQAALKLNEQVYVVWEQVINIQTLLGHYEE
AIKVGDEALSIYPNQASLYYYMAYALFKTGKYEPAQSNLKTSLQLDVENKSLQAQIYALQ
GDIYINQNNFALAKTAFEKAISTEPDNYLIMNNYAYYLALRNDDLTKAAKYAETAANAMP
NNPSIVDTYAFILFKQQKYDLAKTWIEKALQNNSSKNGVYLERYGDILFMKGEKDAALIQ
WQKAKEAGNGSEVLIKKINEKKYFK