Protein Info for CA265_RS18930 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: N-acetylglucosamine-6-phosphate deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00221: N-acetylglucosamine-6-phosphate deacetylase
  • amino acids 4 to 360 (357 residues), 312.8 bits, E=1.6e-97
• PF01979: Amidohydro_1
  • amino acids 46 to 356 (311 residues), 75.2 bits, E=2.9e-25

Best Hits

KEGG orthology group: K01443, N-acetylglucosamine-6-phosphate deacetylase [EC: 3.5.1.25] (inferred from 60% identity to phe:Phep_0114)

Predicted SEED Role

"N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.1.25)

MetaCyc Pathways

• N-acetylglucosamine degradation II (3/3 steps found)
• N-acetylglucosamine degradation I (2/2 steps found)
• superpathway of N-acetylneuraminate degradation (16/22 steps found)
• D-galactosamine and N-acetyl-D-galactosamine degradation (2/4 steps found)
• superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (3/6 steps found)
• N-acetyl-D-galactosamine degradation (2/5 steps found)
• peptidoglycan recycling I (8/14 steps found)
• chitin derivatives degradation (3/8 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.25

Sequence Analysis Tools

See A0A1X9Z8Q0 at UniProt or InterPro

Protein Sequence (363 amino acids)

>CA265_RS18930 N-acetylglucosamine-6-phosphate deacetylase (Pedobacter sp. GW460-11-11-14-LB5)
MPKVITNTSYFQDNEIKSNQDILIEGSTISIINSSENKETSQSLTIPGFIDLQIYGAAGR
LFSADPTVESLTIMEDDLLKKGTTGFLACMATNSSEVFNACIKAAKEHRSAAKNCLGLHL
EGPFLNPKRLGAHVPAFVRKASLDEIKELIDFGDGVIKMMTIAPEIQDDEVIQYLLDHGV
VVSLGHSNATFDEATAAYNKGIQTTTHLFNAMSPIHHREPGIPTAVFNHNKAMASIIADG
QHVDFEVLKFAQKLLKERLFLITDAVTACSTGPYQHVEKENKYVMPDGTLSGSSITMLQA
VKNCVTHCAISLSDGVKMGTLYPAQLIGIENLTATIATGHQANLLVLDDELSLKEVIFRG
ETI