Protein Info for CA265_RS18400 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: iron-sulfur cluster-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 TIGR00273: iron-sulfur cluster-binding protein" amino acids 40 to 411 (372 residues), 457.9 bits, see alignment E=1.7e-141 PF02589: LUD_dom" amino acids 68 to 291 (224 residues), 152.3 bits, see alignment E=4.7e-48 PF13183: Fer4_8" amino acids 309 to 374 (66 residues), 52.9 bits, see alignment E=1.6e-17 PF13534: Fer4_17" amino acids 310 to 375 (66 residues), 28.9 bits, see alignment E=4.7e-10 PF12838: Fer4_7" amino acids 310 to 374 (65 residues), 27.8 bits, see alignment E=1e-09

Best Hits

KEGG orthology group: None (inferred from 85% identity to phe:Phep_3823)

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z8B7 at UniProt or InterPro

Protein Sequence (461 amino acids)

>CA265_RS18400 iron-sulfur cluster-binding protein (Pedobacter sp. GW460-11-11-14-LB5)
MNIAEEFLEKSDEKAFDLPHRKTINYNIGKYNAAVERGLSKFENLEASKKKAHVIKWRVM
ENLDKFLPEFESNFQRRGGKVIWANDAEEAQQEILNIIKRNNGKTVIKSKSMTTEEIHLN
DFLEKNNIESLESDLGEYIVQLLGQAPYHIVTPAMHLSATDIAQLFHDKFGTPIDATPPQ
LVQKARELLRDKYLNADIGISGGNFLIADTGSIALTENEGNARLSTTFPKIHIAIVGIEK
VIPSIADLDLFWPLLASHGTGQNLTVYNTILSGPRQPNETDGPEEMYVILLDNGRTNLLA
QKDQRQGLYCIRCGACLNACPVYKNIGGHTYNTTYSGPIGSVITPHLKGMEEFKHLSYAS
SLCGKCSEVCPVKIDIHKMLLLNRRDAAAGHENGKKEEIGWSMFSRMMQKRKWMDFFGGK
FKNFMLKRFFKKSWGKYREMPKVADKSFAKQWEEMKKSKES