Protein Info for CA265_RS18280 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 135 to 152 (18 residues), see Phobius details amino acids 159 to 190 (32 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details amino acids 277 to 295 (19 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details amino acids 329 to 350 (22 residues), see Phobius details PF13231: PMT_2" amino acids 63 to 219 (157 residues), 80.5 bits, see alignment E=8.9e-27

Best Hits

KEGG orthology group: None (inferred from 48% identity to hhy:Halhy_1921)

Predicted SEED Role

"4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family" in subsystem Pterin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z9G6 at UniProt or InterPro

Protein Sequence (520 amino acids)

>CA265_RS18280 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MENKMNHKKSKSALVDLGILVFFVILKLILPFLLVNAAYSLHRDEFLHLDQANHLAWGFQ
SVPPVTSIFALIIKLLGSSEAVVRLVSASIGGATLVFTWKIVEALKGNLYAKALSAIALI
CCAIGRLDLLFQPNAFDILSWTAVYFILIRFFDTKENRFLYFLAIALGLGFLNKYSIVFL
AAGLIPALLISKQRAVFRNKHLYFAALLALFIMLPNLIWQYTHHFPVVGHMKELAATQLD
KINRIDFLKDQLLYYFNVIFIVLAGIIALLFYKPFAAFRWVIFGFIISLGLFTWFRAKGY
YAAGLYPVIIAAGCAYFSLVLHKGWKKYLKVLMIVLPIALFSITMKFAYPVLSPEQIIAK
HDKFGKIGMLRWEDGLQHDLPQDFADMQGWKEMAALTDLAYAKVKDKSALLVRADNYGEA
GAINYYSKFKNINAVAYNADYLYWFKMDKPIKHLILIRELGEEDPQRKKEQPFFGKITKI
GEVTTPYAREKGASVFLLEDAHIDINSRINSEIEEEKHDH