Protein Info for CA265_RS18140 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: DUF4271 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 116 to 134 (19 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 202 to 227 (26 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details PF14093: DUF4271" amino acids 121 to 323 (203 residues), 126.6 bits, see alignment E=6.6e-41

Best Hits

KEGG orthology group: None (inferred from 56% identity to phe:Phep_0381)

Predicted SEED Role

"FIG00907509: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z8A7 at UniProt or InterPro

Protein Sequence (325 amino acids)

>CA265_RS18140 DUF4271 domain-containing protein (Pedobacter sp. GW460-11-11-14-LB5)
MPKFIFILFAFLCSTHFVAAQEIPVQTDSVTVNQYQYRRYRPDSATLARQKFSTDSLVRH
TWVLPDSLINKGALLDTIEKEYLFPKLDLLAWQKKYQHLKKKANPYQLGTKIPKGNVGLL
GFIFGMLIIFAILKNAFSKQLSAIVQSFFSNRILNNINKEDNLFSSWPFLLLFVQFGFVF
GMFFFLVAQWNDMYQAKDGFKFFFSISITIIVFYALKLVLLRFLGYLFNVQKPVGEYISI
LYLSYFNASLLFIPLVVAFALSPLKYGAVYIVLAFLLLGIIFAFQLLRAGITILSNNKFS
RMHLFLYFCALEICPILILIKTIGL