Protein Info for CA265_RS18135 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: uroporphyrinogen-III synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02602: HEM4
  • amino acids 32 to 244 (213 residues), 108.3 bits, E=1.8e-35

Best Hits

KEGG orthology group: K01719, uroporphyrinogen-III synthase [EC: 4.2.1.75] (inferred from 86% identity to phe:Phep_0382)

Predicted SEED Role

"uroporphyrinogen-III synthase HemD, putative"

MetaCyc Pathways

• superpathway of heme b biosynthesis from glutamate (9/10 steps found)
• tetrapyrrole biosynthesis I (from glutamate) (6/6 steps found)
• superpathway of heme b biosynthesis from glycine (6/8 steps found)
• tetrapyrrole biosynthesis II (from glycine) (3/4 steps found)
• adenosylcobalamin biosynthesis II (aerobic) (12/33 steps found)
• superpathway of bacteriochlorophyll a biosynthesis (6/26 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (12/36 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.75

Sequence Analysis Tools

See A0A1X9Z869 at UniProt or InterPro

Protein Sequence (256 amino acids)

>CA265_RS18135 uroporphyrinogen-III synthase (Pedobacter sp. GW460-11-11-14-LB5)
MQEKNDSRIRKVKSILVTLPKPETEKSPYYDLAKKHNLKVDFRSFIHVEGVPARDFRKDK
INLADFTAVIFTSRNAADHFFRICEEMRYEVPAELKYFCLSETIALYLQKYIQYRKRKIF
FGKQTAADLAEVLKKHANEKFLYPCSDMATEDTMKFLEKSGYNFTPAVLFKTVVSDLSDL
AEVFYDVIAFFSPSSIQSLFKNFPDFKQNNTRIAAFGTNTSKACTDMDLIVDIAAPTPGV
PSMTMAIENYIKISNK