Protein Info for CA265_RS18120 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: gliding motility protein GldM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details TIGR03517: gliding motility-associated protein GldM" amino acids 1 to 507 (507 residues), 351.9 bits, see alignment E=3.4e-109 PF12081: GldM_1st" amino acids 32 to 215 (184 residues), 157.3 bits, see alignment E=1e-49 PF21601: GldM_2nd" amino acids 218 to 316 (99 residues), 95.8 bits, see alignment E=3.6e-31 PF21602: GldM_3rd" amino acids 318 to 401 (84 residues), 70.8 bits, see alignment E=1.9e-23 PF12080: GldM_4th" amino acids 404 to 509 (106 residues), 77.3 bits, see alignment E=3.1e-25

Best Hits

KEGG orthology group: None (inferred from 67% identity to phe:Phep_0385)

Predicted SEED Role

"FIG00908059: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z8D5 at UniProt or InterPro

Protein Sequence (510 amino acids)

>CA265_RS18120 gliding motility protein GldM (Pedobacter sp. GW460-11-11-14-LB5)
MAGGKETTRQRMINIMYLVLLAMLALNVSDTILDAFKNINDSLDTSKNNVNTSINQLFSA
FENSKLKEEPARAQPIYDKAKQAQKAADDLNNYIESIKKEFTQAGDGIDPETEDLVNRSN
QDIAQNIMINQKKADELKKRINATREKLISLLDPADRANVSFSLEAKDPARKRKGNWQET
YFGEGTPLTAAMTILTKLQTDTKNAEAEVVKKLFGNMDKAQVNLDQFAAVAVAPTSYVIQ
GQPYTAEVFLTASDSRSTPDITVNGSKLSVKDGKGTYSGGTSSVGQFTWVGTVRVRQTDG
QVKEYKTQPQTYQVAKPSASVSSTKLNVIYAGIPNPFTVSAAGFPLESIRASISGGSMSG
SNGNYNVKVPGSLVGQDVSINVSANNAGKTVSLGSQKFRVKGIPTPVAKVGGRAGGDVAS
VQLKSETEIEADLDDFPFDVKFKIQRYKLTIIKPRSDAVTIPGSGGSFAGAVKGAINSIT
PGTRVFFEDIVSIGPDGRQKILPSLAFSVK