Protein Info for CA265_RS18060 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: ATP synthase F1 subunit delta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01145: ATP synthase F1, delta subunit
  • amino acids 6 to 175 (170 residues), 116.4 bits, E=8.3e-38
• PF00213: OSCP
  • amino acids 6 to 176 (171 residues), 152.7 bits, E=5.5e-49

Best Hits

Swiss-Prot: 40% identical to ATPD_CYTH3: ATP synthase subunit delta (atpH) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K02113, F-type H+-transporting ATPase subunit delta [EC: 3.6.3.14] (inferred from 68% identity to phe:Phep_0395)

Predicted SEED Role

"ATP synthase delta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

See A0A1X9Z9E0 at UniProt or InterPro

Protein Sequence (179 amino acids)

>CA265_RS18060 ATP synthase F1 subunit delta (Pedobacter sp. GW460-11-11-14-LB5)
MSEIKVASRYAKSLIDLAVENNALEASYNDMVLFEKVVDETPELEAILKNPIVPLDKKTG
ILNGIFADKVSKLTISFFKIVVNKGRSAILFATAKQFVQQYNLIKGIVTADVTTASALSP
AAKEQIVAIVKRELNANQVIVNEKINEKLIGGFILKVGDKQFDASIASGLSKLKKEFAQ