Protein Info for CA265_RS17785 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 9 to 27 (19 residues), see Phobius details PF00578: AhpC-TSA" amino acids 65 to 143 (79 residues), 28.2 bits, see alignment E=1.6e-10 PF02630: SCO1-SenC" amino acids 67 to 193 (127 residues), 29.9 bits, see alignment E=5e-11

Best Hits

KEGG orthology group: None (inferred from 51% identity to phe:Phep_0301)

Predicted SEED Role

"chain A, Identification Of A Disulfide Switch In Bssco, A Member Of The Sco Family Of Cytochrome C Oxidase Assembly Proteins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z8P7 at UniProt or InterPro

Protein Sequence (231 amino acids)

>CA265_RS17785 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MKRSPIKKVIILVSILAIPGFLFFYLLPQFAKNRYKSLPIFGEKVVASTFHSVKGKKIPD
TIYHLVPDFKLVNQHNDTVTWKSLENKIVVLNMFYTSANNQGTSKYIKELADGYAQKPLV
KFLSLSVDPLDGTRIKDFAEQFKAKAGKWDFLVGDTIQTYPLIRKGLLLDVIADETKEKT
NFIFSNKIVLIDNLHRIRGIYEADDAGANARLEDEIKVLIAEYLRNVKDGR