Protein Info for CA265_RS17435 in Pedobacter sp. GW460-11-11-14-LB5
Annotation: DNA repair protein RecO
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 35% identical to RECO_BACFN: DNA repair protein RecO (recO) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)
KEGG orthology group: K03584, DNA repair protein RecO (recombination protein O) (inferred from 70% identity to phe:Phep_0459)Predicted SEED Role
"DNA recombination and repair protein RecO" in subsystem DNA repair, bacterial RecFOR pathway
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1X9Z7V2 at UniProt or InterPro
Protein Sequence (241 amino acids)
>CA265_RS17435 DNA repair protein RecO (Pedobacter sp. GW460-11-11-14-LB5) MLHKVRGIVLKTTNYSESSVVVQVLTDKFGMQSYLINGVKKPKAKIKMNMLQSLHLLDMV VYHKTNTNIQRVSEVRQTPVFKSIPYDMIKTSIVIFLNEVLYKSIRQQSADESLFDYIFN SIAWFDEIEEINPNFHLSFLLKLTRFLGFSPNEKRRNDQIYFDLQEGEFTSRLPIHSNYL QLEDALGFISLFHTPLEKISEIKMSNAQRRFLLDKILVFYTLHTASFGVVQSHKILETLL S