Protein Info for CA265_RS17435 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: DNA repair protein RecO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 212 to 230 (19 residues), see Phobius details PF11967: RecO_N" amino acids 1 to 76 (76 residues), 66.7 bits, see alignment E=1.5e-22 TIGR00613: DNA repair protein RecO" amino acids 4 to 155 (152 residues), 59.3 bits, see alignment E=1.9e-20 PF02565: RecO_C" amino acids 87 to 224 (138 residues), 43.2 bits, see alignment E=3.7e-15

Best Hits

Swiss-Prot: 35% identical to RECO_BACFN: DNA repair protein RecO (recO) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K03584, DNA repair protein RecO (recombination protein O) (inferred from 70% identity to phe:Phep_0459)

Predicted SEED Role

"DNA recombination and repair protein RecO" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z7V2 at UniProt or InterPro

Protein Sequence (241 amino acids)

>CA265_RS17435 DNA repair protein RecO (Pedobacter sp. GW460-11-11-14-LB5)
MLHKVRGIVLKTTNYSESSVVVQVLTDKFGMQSYLINGVKKPKAKIKMNMLQSLHLLDMV
VYHKTNTNIQRVSEVRQTPVFKSIPYDMIKTSIVIFLNEVLYKSIRQQSADESLFDYIFN
SIAWFDEIEEINPNFHLSFLLKLTRFLGFSPNEKRRNDQIYFDLQEGEFTSRLPIHSNYL
QLEDALGFISLFHTPLEKISEIKMSNAQRRFLLDKILVFYTLHTASFGVVQSHKILETLL
S