Protein Info for CA265_RS17280 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 693 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 70 to 87 (18 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 390 to 409 (20 residues), see Phobius details amino acids 415 to 433 (19 residues), see Phobius details amino acids 446 to 478 (33 residues), see Phobius details amino acids 484 to 502 (19 residues), see Phobius details amino acids 514 to 534 (21 residues), see Phobius details PF12805: FUSC-like" amino acids 74 to 345 (272 residues), 118.1 bits, see alignment E=6.2e-38 PF11744: ALMT" amino acids 393 to 593 (201 residues), 29.8 bits, see alignment E=4.6e-11 PF13515: FUSC_2" amino acids 403 to 526 (124 residues), 64.7 bits, see alignment E=1.4e-21

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z8S1 at UniProt or InterPro

Protein Sequence (693 amino acids)

>CA265_RS17280 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MGKNSIGSTISYFFLGEYFSDALRTTITVVLPIILFFYLGNPEAAKGIGVGALLISLTDL
PDNRLNKLKTALWSIIVFFGTTLVVSSVLDHVYLTAIVVVIAAFSFSMFAVYGQKLSLIG
TMALIVCTFVMGLHPARPLYFSSYILLGGVWYYVISLIQILIRPYRSLHHAIFECLMSSA
VFLNAKARNYDVDVPLDLQQKEAIKLHIEVNQKHELIRNLLLTDKYAMNPDNPKGQLLLE
RARLLIDLYEQLNAVHYDYALVRKTLATGPSLKLIASLIELLAKELEQLGRHVRSAKAYK
GEVATNIEYYQKRVMLLQEMERLNESQRKIVLKVVSNMNDIVRIIEMIRGNERTPEKHLQ
ELRGSISYPLFITGDRFSIKEHLTLKSPIFRFSLRLAICFLFGFLLIWQLEPSKYSYWLF
LTLVIVARPKFSITWKRNLQRLKGSLGGVVIGLIIIYFVKSQAVLLSFSVIFLLGFYAFN
RLNYTVSVLFITPAVILTLGSYQGHFDHIVHDRIMFTVLGCVIAIFATYLFPIWDSRQLK
AKISKATNDSLHYLQVAIERKENLGENISRMARKNANLSLSALSEAIESASQEPMRKHID
FNGLYGVQSTIYQINAIITSIYLSLNHKPEQADPLLVKQIVSNLSNEAVLTNDAIAPVDV
MDVNHDDHSTRQKLAHIAMLSFDFRRFSAGFRG