Protein Info for CA265_RS16595 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 35 to 59 (25 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details PF06580: His_kinase" amino acids 154 to 234 (81 residues), 65.3 bits, see alignment E=2.5e-22

Best Hits

KEGG orthology group: None (inferred from 45% identity to cpi:Cpin_3395)

Predicted SEED Role

"putative two-component system sensor protein, no kinase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z7K9 at UniProt or InterPro

Protein Sequence (376 amino acids)

>CA265_RS16595 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MIKHKYRLVTYHIIFWVIYVLLNNILTYAQNPKSYIFNIGDIFLFQIPNICTVYLCILAC
RKYTNPLKPFSLFLGITIAFACSYLLWYATTYHIRPYVNANGSTPAPFNFINYGAAVLLV
FIRYSIIGIGYHFASEGIKRERKLRLIEKEKHEAEYAFLRAQINPHFLNNTLNFFFAKSL
PLSEELANGIMTLSEIMRYSLEIDKDDRMTLIDEEIDHIKNVIKINQLRFNNKLQIDFKV
NGNTDHVRLIPLILITIVENILKHGNCTENMHPVKILLSINEIDHNIHLSTWNKKKNGPK
ELSSGIGMENIKKRLTNHYNKGFALNINETEFDYSLELTLPYNKITDHQEKPSSFDNLGF
LEHFKLPPIKPQPYTS