Protein Info for CA265_RS16375 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: glycerol-3-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01210: NAD_Gly3P_dh_N
  • amino acids 1 to 158 (158 residues), 101.2 bits, E=1.2e-32
• PF03807: F420_oxidored
  • amino acids 2 to 104 (103 residues), 21.8 bits, E=4.7e-08
• PF07479: NAD_Gly3P_dh_C
  • amino acids 179 to 316 (138 residues), 154.7 bits, E=3.9e-49
• PF20618: GPD_NAD_C_bact
  • amino acids 239 to 305 (67 residues), 77.8 bits, E=1.5e-25

Best Hits

KEGG orthology group: K00057, glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC: 1.1.1.94] (inferred from 78% identity to phe:Phep_0664)

Predicted SEED Role

"Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.94)

MetaCyc Pathways

• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• glycerol-3-phosphate shuttle (2/2 steps found)
• CDP-diacylglycerol biosynthesis III (3/5 steps found)
• glucosylglycerol biosynthesis (3/5 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (8/13 steps found)
• 1,3-propanediol biosynthesis (engineered) (5/9 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.94

Sequence Analysis Tools

See A0A1X9ZDB0 at UniProt or InterPro

Protein Sequence (327 amino acids)

>CA265_RS16375 glycerol-3-phosphate dehydrogenase (Pedobacter sp. GW460-11-11-14-LB5)
MIGGGSWATAIVKMLADNLAEKEIFWWMRNEAAIAHIKKFKHNPNYISSVEIKLTQENNI
SSDINAIINSAEFVILNVPAAFLKETLSTITAEDLKGKKIVSAIKGIVPEDNLIIGEFLH
KNYGIPYHDILVVSGPCHAEEVALEKLSYLTIACTDVEKAATFASFLNTRYIKTNVSDDI
FGTEYAAVLKNIYAVASGICHGIGYGDNFQAVLISNAIREIKRFVDAVHPIDRDIKESAY
LGDLLVTAYSQFSRNRTFGNMIGKGYTVKSAQLEMNMIAEGYYAVKCMHIKNQAYHVDMP
ICKAVHSIIYENHSPHIEMKLLAEKLN