Protein Info for CA265_RS16155 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: tRNA pseudouridine(55) synthase TruB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 TIGR00431: tRNA pseudouridine(55) synthase" amino acids 18 to 225 (208 residues), 200.1 bits, see alignment E=1.8e-63 PF01509: TruB_N" amino acids 46 to 187 (142 residues), 168.1 bits, see alignment E=8.8e-54

Best Hits

Swiss-Prot: 56% identical to TRUB_FLAJ1: tRNA pseudouridine synthase B (truB) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: K03177, tRNA pseudouridine synthase B [EC: 5.4.99.12] (inferred from 82% identity to phe:Phep_3547)

Predicted SEED Role

"tRNA pseudouridine synthase B (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z8D0 at UniProt or InterPro

Protein Sequence (243 amino acids)

>CA265_RS16155 tRNA pseudouridine(55) synthase TruB (Pedobacter sp. GW460-11-11-14-LB5)
MSTENSKFKDFNFAEGELLLINKPYKWTSFDVVGKIRNSLKPLKLKVGHAGTLDPLATGL
LIICTGKLTKQIDTFQAEEKEYTGTMILGATTPSFDMETEVDQTFDISNISEDEIYAACK
PFIGDIEQYPPAHSAVKVNGERLYVKARLGEEVELRKRFVSVLEFEITRIELPEIDFRIV
CSKGTYIRSLISDFGKTLNRGAYLSKLTRTRSGNFLLKDAFEVLELVNYIRSKKEEAKTE
AEA