Protein Info for CA265_RS16100 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: serine/threonine protein kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 41 to 63 (23 residues), see Phobius details amino acids 84 to 108 (25 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 331 to 350 (20 residues), see Phobius details amino acids 356 to 378 (23 residues), see Phobius details amino acids 390 to 415 (26 residues), see Phobius details amino acids 421 to 441 (21 residues), see Phobius details PF13520: AA_permease_2" amino acids 7 to 422 (416 residues), 180.4 bits, see alignment E=6e-57 PF00324: AA_permease" amino acids 12 to 412 (401 residues), 103.6 bits, see alignment E=1.1e-33

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z7C5 at UniProt or InterPro

Protein Sequence (445 amino acids)

>CA265_RS16100 serine/threonine protein kinase (Pedobacter sp. GW460-11-11-14-LB5)
MQQKKQLSLFDLSMIVVSLVIGMGVFRTPVNVAAKAQIPELFYLAWFIGGFVAFCGALTY
AEIGSRFPVTGGYYKIFSAAYHPSIAFAINCIVIISSAASVAAISIIGAEYLSKIILPVD
KQTETYRVAIAITTILAFYFINLLGLKASSKTQNVLTVIKIGMILTLICAIFFGGQTQTV
TPVFKTVSGAMPTWSDYGKALGLCLIAVSFSYAGYAQTINFGGEVKEAKKVIPRSIIIGL
TIIVILYLAINYVYVKVIGFEELKTAESIAAILASKIFGPAGFNALSVIIFFSVMGYVNV
NLLSNPRAMFAMGEEGALPKIFSRMNKKTEVITISLSIFTLIAVVIIFYAKTFDKILNYT
IFLESISMASSAATIFILRKRTAHLDKKTIYTVPLYPILPIIFIAAYTFVAFSIYADDPN
AALNGLYIFAGFLAIYFVSRWFNKK