Protein Info for CA265_RS16090 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: ribonuclease BN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 37 to 60 (24 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 149 to 175 (27 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 235 to 258 (24 residues), see Phobius details amino acids 266 to 290 (25 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 23 to 296 (274 residues), 82 bits, see alignment E=3.1e-27 PF03631: Virul_fac_BrkB" amino acids 27 to 300 (274 residues), 178.5 bits, see alignment E=1e-56

Best Hits

KEGG orthology group: K07058, membrane protein (inferred from 68% identity to phe:Phep_3473)

Predicted SEED Role

"Ribonuclease BN (EC 3.1.-.-)" in subsystem LMPTP YfkJ cluster or tRNA processing (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z7Z8 at UniProt or InterPro

Protein Sequence (340 amino acids)

>CA265_RS16090 ribonuclease BN (Pedobacter sp. GW460-11-11-14-LB5)
MRVLHKIKYFFIALYHLFVAAGKGFVEDRVTKLSASLAYYTIFSLTPLIIIMLSAATLFF
GDKRNEETRVQFYGQVTEMVGKEAATQIQGFVEHANKSGQSTLGLIIGIGTLIIGSTAIF
IEIQDSINMIWKVKAVPKKGWIKMLSNRLLSFSLIVSMGFLLLVSLVVNTVVVGLGSKLG
NLLSQSKIDEVIPVANDTMAILIYILNNVITLAAVTAVFAVIFKVLPDVIIRWKSAIIGA
LFTAVLFSLGKYLIGIYIEKGNPGSAFGAASSIIVILLWIYYTSIILYFGAEFTQAYAEK
YDNGIAPSKYAVFTKITIVEKKVDVLPPQHPEDTVNVPKE