Protein Info for CA265_RS15940 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: DNA-binding response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF00072: Response_reg" amino acids 7 to 116 (110 residues), 108.8 bits, see alignment E=1.7e-35 PF00486: Trans_reg_C" amino acids 157 to 230 (74 residues), 73 bits, see alignment E=1.7e-24

Best Hits

Swiss-Prot: 38% identical to WALR_BACSU: Transcriptional regulatory protein WalR (walR) from Bacillus subtilis (strain 168)

KEGG orthology group: K07658, two-component system, OmpR family, alkaline phosphatase synthesis response regulator PhoP (inferred from 94% identity to phe:Phep_3446)

Predicted SEED Role

"Phosphate regulon transcriptional regulatory protein PhoB (SphR)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z876 at UniProt or InterPro

Protein Sequence (234 amino acids)

>CA265_RS15940 DNA-binding response regulator (Pedobacter sp. GW460-11-11-14-LB5)
MSQKLRILLVEDEDHLLDAIKLNLELEGYKVHAVKDGKTALKIFKEERFNLIILDVMLPE
MDGFQVCETIRLENAEVPIMFLTAKNTSEDRVLGLKKGADDYLVKPFNLEELILRVGILV
KRSLKSDDLKELNSYKIGDKTIYFNSFELKHDDGTITPLTKKETMLLKLLIERKNDAVSR
EQILETVWNYDVYPSTRTIDNFILTFRKYFEPDQKNPVYFHSIRGVGYKFTDSH