Protein Info for CA265_RS15845 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: molybdenum ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 PF00005: ABC_tran" amino acids 22 to 176 (155 residues), 66.8 bits, see alignment E=7.9e-22 amino acids 275 to 427 (153 residues), 76.2 bits, see alignment E=9.6e-25

Best Hits

KEGG orthology group: K05776, molybdate transport system ATP-binding protein (inferred from 72% identity to psn:Pedsa_2354)

Predicted SEED Role

"Putative molybdenum transport ATP-binding protein modF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z714 at UniProt or InterPro

Protein Sequence (487 amino acids)

>CA265_RS15845 molybdenum ABC transporter ATP-binding protein (Pedobacter sp. GW460-11-11-14-LB5)
MMFKPFLHIQDLNLSYSNKAVLKDLYWEMNVGESYVIGGKSGTGKTSLAKAIAGLIQTQG
NIEIDFDELSKLPKEVLYVESWYQFKNLEGVANFYYQQRYTSQQAKETLTVHAELVSYGK
EKGLHFDQVEPILEALGFATFASSQLIELSSGEHKKLQLVKALWLKPQLLVIDQPYTGLD
AASRKNLNILLDQVSEEGVQLILICNETELPTSINSFAEIRDGQLIKVETLESVANTEIH
LRKIPAFLKESPVYSSQDIVKMVNVNISYGEKQVLKNINWEIKAGEKWLLQGHNGSGKST
LLSLVNGDHPQSYANELYLFGNRRGSGESIWDIKQHIGLISPEFHWYFDATATVWQSIAS
GFYDTVGLFQVLPYTKSTQVDELVAYFGLTENKNELLTALPLGKQRLVLLARTIIKNPEL
LILDEPCQGLDQQQTRHFNQLVDELCSNGMTLIYVGHFESQLPACIEKRILLEKGEVKVV
ETILENV