Protein Info for CA265_RS15560 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: glutamate/aspartate:proton symporter GltP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 70 (25 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 227 to 248 (22 residues), see Phobius details amino acids 308 to 327 (20 residues), see Phobius details amino acids 338 to 364 (27 residues), see Phobius details PF00375: SDF" amino acids 14 to 403 (390 residues), 387.4 bits, see alignment E=4e-120

Best Hits

Swiss-Prot: 54% identical to DCTA_AERS4: C4-dicarboxylate transport protein (dctA) from Aeromonas salmonicida (strain A449)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 65% identity to cpi:Cpin_1399)

MetaCyc: 55% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z7N1 at UniProt or InterPro

Protein Sequence (428 amino acids)

>CA265_RS15560 glutamate/aspartate:proton symporter GltP (Pedobacter sp. GW460-11-11-14-LB5)
MTVTEFIKKVFSNLTFQVLLAIIIGIYVGAYFPGFAPTAKLISQGFINLISMLIAPIIFF
TIVLGIAHMGDMKKVGRVGGKALLYFEIVSTVAIAIGLLVANVLKPGAGMIAKAGDATKI
AGYAEQAKDMNWAEFFLHIIPHNIIASFAEGNILQILLFAILFGYGLNKLGGEGTTVLNA
FDKISKVLFKIMKLIMRLAPIGAFGGMAFSIGTHGLESIVGMAKLMGSVYLTCFLFIFVI
LNGICRYYNFSLWAYLKYIRQEILIVLGTSSSESALPSMMQKMEAIGCDKSVVGLVIPTG
YSFNLDGTAIYLAMAVIFLCQVFHVDLTLGQQITVLGVLMITSKGAAGVTGSGFIVLVST
LTALKIMPIEHISILIGVDRFMSEARAITNVIGNGVATIVIAKSEKQFDEQKYLKAIQPA
MIEKAEEV