Protein Info for CA265_RS15465 in Pedobacter sp. GW460-11-11-14-LB5
Annotation: acyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 45% identical to AGUB_ORYSJ: N-carbamoylputrescine amidase (CPA) from Oryza sativa subsp. japonica
KEGG orthology group: K12251, N-carbamoylputrescine amidase [EC: 3.5.1.53] (inferred from 92% identity to phe:Phep_0693)Predicted SEED Role
"N-carbamoylputrescine amidase (3.5.1.53)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism
MetaCyc Pathways
- L-arginine degradation IV (arginine decarboxylase/agmatine deiminase pathway) (3/3 steps found)
- putrescine biosynthesis II (3/3 steps found)
- superpathway of polyamine biosynthesis II (5/8 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.5.1.53
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1X9Z7X6 at UniProt or InterPro
Protein Sequence (291 amino acids)
>CA265_RS15465 acyltransferase (Pedobacter sp. GW460-11-11-14-LB5) MKKVKVGLVQMSCTKVKQENLDKAIAKVREAAAKGAQIVCLQELFTSLYFCDVEDYDNFD LAEAIPGPSTDALQVVAKELGVVIIASLFEKRAEGLYHNTTAVLDADGSYLGKYRKMHIP DDPAFYEKFYFTPGDLGYKVFETKFAKIGILICWDQWYPEASRITALMGADIMFYPTAIG WATDQDEETNQDQYNAWQTIQRSHAVANGVPVVSVNRVGFEQDGAMKFWGGSFATNGQGK LLYLASHDLEETEVVELDLSESDFFRKHWPFLRDRRIDSYQPITKRYIDGD