Protein Info for CA265_RS15435 in Pedobacter sp. GW460-11-11-14-LB5
Updated annotation (from data): glycine transporter
Rationale: Specific phenotype: utilization of Glycine. Belongs to the UPF0126 family of transporters (see PMID:29769716)
Original annotation: hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 48% identical to YICG_ECOL6: UPF0126 inner membrane protein YicG (yicG) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
KEGG orthology group: None (inferred from 64% identity to put:PT7_2401)Predicted SEED Role
"putative membrane protein"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1X9Z6X7 at UniProt or InterPro
Protein Sequence (204 amino acids)
>CA265_RS15435 glycine transporter (Pedobacter sp. GW460-11-11-14-LB5) MLHILYIIAITAEAMTAALSAGRRDMDWVGVCIIAWVTALGGGTVRNVLFGHYPMSWVEH PEYLVITAVAALLAAFIASIMTKLKKLFLYLDALGLVVFTIIGCQVAQQIHLPYLIVLFS GMITGCAGGVLRDVLCNEVPFLFRKEIYASAAIVTGAVYIGIEHFHGSEMLATITAAIIG LTLRLLSIRFEWHMPKFVYRDEWH