Protein Info for CA265_RS15435 in Pedobacter sp. GW460-11-11-14-LB5

Updated annotation (from data): glycine transporter
Rationale: Specific phenotype: utilization of Glycine. Belongs to the UPF0126 family of transporters (see PMID:29769716)
Original annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 transmembrane" amino acids 7 to 20 (14 residues), see Phobius details amino acids 28 to 49 (22 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 147 to 164 (18 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details PF03458: Gly_transporter" amino acids 4 to 77 (74 residues), 70.7 bits, see alignment E=4e-24 amino acids 90 to 162 (73 residues), 82.7 bits, see alignment E=6.8e-28

Best Hits

Swiss-Prot: 48% identical to YICG_ECOL6: UPF0126 inner membrane protein YicG (yicG) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 64% identity to put:PT7_2401)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z6X7 at UniProt or InterPro

Protein Sequence (204 amino acids)

>CA265_RS15435 glycine transporter (Pedobacter sp. GW460-11-11-14-LB5)
MLHILYIIAITAEAMTAALSAGRRDMDWVGVCIIAWVTALGGGTVRNVLFGHYPMSWVEH
PEYLVITAVAALLAAFIASIMTKLKKLFLYLDALGLVVFTIIGCQVAQQIHLPYLIVLFS
GMITGCAGGVLRDVLCNEVPFLFRKEIYASAAIVTGAVYIGIEHFHGSEMLATITAAIIG
LTLRLLSIRFEWHMPKFVYRDEWH