Protein Info for CA265_RS15360 in Pedobacter sp. GW460-11-11-14-LB5

Updated annotation (from data): predicted cytochrome c component of periplasmic glucoside 3-dehydrogenase (EC 1.1.99.13)
Rationale: Although we do not have fitness data for this gene, a similar protein (Echvi_1841) is also part of a cluster with glucoside 3-dehydrogenase (lacAC) and has similar phenotypes. This is probably the cytochrome c subunit, replacing lacB.
Original annotation: cytochrome C552

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00034: Cytochrom_C
  • amino acids 45 to 126 (82 residues), 34.8 bits, E=1.8e-12

Best Hits

KEGG orthology group: None (inferred from 43% identity to fba:FIC_02105)

Predicted SEED Role

"Cytochrome c551/c552" in subsystem Soluble cytochromes and functionally related electron carriers

KEGG Metabolic Maps

• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.99.13

Use Curated BLAST to search for 1.1.99.13

Sequence Analysis Tools

See A0A1X9Z7V6 at UniProt or InterPro

Protein Sequence (127 amino acids)

>CA265_RS15360 predicted cytochrome c component of periplasmic glucoside 3-dehydrogenase (EC 1.1.99.13) (Pedobacter sp. GW460-11-11-14-LB5)
MKKTFLILGAVVIFMASFSKADLSREKTVVATATMTKHAAFQSNPGEKLINKSDCLGCHN
KTNKIIGPAYVEIAKKYPATEKNINMLADKIIKGGTGVWGNMPMTAHATLKKDDAKLMVK
YILSLKK