Protein Info for CA265_RS15360 in Pedobacter sp. GW460-11-11-14-LB5

Updated annotation (from data): predicted cytochrome c component of periplasmic glucoside 3-dehydrogenase (EC 1.1.99.13)
Rationale: Although we do not have fitness data for this gene, a similar protein (Echvi_1841) is also part of a cluster with glucoside 3-dehydrogenase (lacAC) and has similar phenotypes. This is probably the cytochrome c subunit, replacing lacB.
Original annotation: cytochrome C552

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00034: Cytochrom_C" amino acids 45 to 126 (82 residues), 34.8 bits, see alignment E=1.8e-12

Best Hits

KEGG orthology group: None (inferred from 43% identity to fba:FIC_02105)

Predicted SEED Role

"Cytochrome c551/c552" in subsystem Soluble cytochromes and functionally related electron carriers

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.99.13

Use Curated BLAST to search for 1.1.99.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z7V6 at UniProt or InterPro

Protein Sequence (127 amino acids)

>CA265_RS15360 predicted cytochrome c component of periplasmic glucoside 3-dehydrogenase (EC 1.1.99.13) (Pedobacter sp. GW460-11-11-14-LB5)
MKKTFLILGAVVIFMASFSKADLSREKTVVATATMTKHAAFQSNPGEKLINKSDCLGCHN
KTNKIIGPAYVEIAKKYPATEKNINMLADKIIKGGTGVWGNMPMTAHATLKKDDAKLMVK
YILSLKK