Protein Info for CA265_RS15280 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: glycine C-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 269 to 290 (22 residues), see Phobius details TIGR01822: glycine C-acetyltransferase" amino acids 7 to 395 (389 residues), 694.5 bits, see alignment E=1.9e-213 PF00155: Aminotran_1_2" amino acids 43 to 384 (342 residues), 223.6 bits, see alignment E=2.4e-70

Best Hits

Swiss-Prot: 62% identical to KBL_ECO57: 2-amino-3-ketobutyrate coenzyme A ligase (kbl) from Escherichia coli O157:H7

KEGG orthology group: K00639, glycine C-acetyltransferase [EC: 2.3.1.29] (inferred from 92% identity to shg:Sph21_1459)

MetaCyc: 62% identical to 2-amino-3-ketobutyrate CoA ligase (Escherichia coli K-12 substr. MG1655)
Glycine C-acetyltransferase. [EC: 2.3.1.29]

Predicted SEED Role

"2-amino-3-ketobutyrate coenzyme A ligase (EC 2.3.1.29)" in subsystem Glycine Biosynthesis or Glycine and Serine Utilization (EC 2.3.1.29)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.29

Use Curated BLAST to search for 2.3.1.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z6U5 at UniProt or InterPro

Protein Sequence (395 amino acids)

>CA265_RS15280 glycine C-acetyltransferase (Pedobacter sp. GW460-11-11-14-LB5)
MYKTLQPVLQKELEEIENAGLFKRERIIITPQGADIKVSGGAEVVNFCANNYLGLSSHPK
VIEAAKKAIDDHGYGMSSVRFICGTQDVHKELEAKISKFLGTEDTILYAAAFDANGGVFE
PLFNAEDAIISDELNHASIIDGVRLCKAQRFRYKNADMEDLEKQLIAAKDCRHRIIVTDG
AFSMDGSVAPLDKIADLADKYEALIMIDESHCTGFIGKNGRGTHEHFNVIDRIDIITGTL
GKALGGASGGFTSGKKEIIDMLRQRSRPYLFSNTLAPAIAGASIAVLDMLSETTSLRDKL
ENNTKYFREKMTEAGFDIKPGFHPIVPVMLYDAKIAQQFAAKMLEEGIYVIGFFYPVVPQ
GKARIRVQLSAGHEQHHLDKAIAAFTKVGKELGVI