Protein Info for CA265_RS15215 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details PF00512: HisKA" amino acids 222 to 285 (64 residues), 38.3 bits, see alignment E=1.1e-13 PF02518: HATPase_c" amino acids 332 to 432 (101 residues), 70.9 bits, see alignment E=1.3e-23

Best Hits

KEGG orthology group: None (inferred from 51% identity to phe:Phep_1184)

Predicted SEED Role

"histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z6Q2 at UniProt or InterPro

Protein Sequence (434 amino acids)

>CA265_RS15215 two-component sensor histidine kinase (Pedobacter sp. GW460-11-11-14-LB5)
MKLQVKFSLYNAVTKIAIILVLGAIILFSLDRLAYNQLDNRLIKKKNKIIENLNDDEIDS
LLNKEQSFTDYNILKEEFIVLTDIPDKQKDSTAKVFTEKREIEGDIEVYRILNYKFSYHT
NWYNLEIGETMTALQSIKNSIRFYMLIVLVAALLITLVADYTFSNFLLKPFYRIIDKKIN
LVDDPSHYNYQNIPTSTSDFKILDNSINSLMRKINTLFALEKQFIANVSHELLTPISILS
TRFENMLNTPDIPEEHENKIYASLKTLNRLKVIINSLLLISKVENNQYLKTEEISLKQEI
EDIYEDLEDRIADKNISYSAHLSKDFHFTGNKALIHTLLINIINNAIKYNVEGGTIAITD
KTEAEKYMLTISDSGSGMSAALVENAFDRFKRGNTEENGFGLGLAIVQSIARFHKIDVEI
KSEEQKGTSISLLF